← Home

arg

Unopinionated, no-frills CLI argument parser

14
Versions
MIT
License
No
Install Scripts
Missing
Provenance

Supply chain provenance

Status for the latest visible version.

No SLSA provenance npm registry signatures gitHead linked

Without SLSA provenance there is no cryptographic link between this tarball and the public source — the axios compromise (March 2026) relied on exactly this gap.

Maintainers

hannesbornolubakravcheaaronbrown-verceldenizkusefjavierbytekayernycjanorygoncycodyogdenfeedthejimtilly3gwitsfeugygbibeaulaviolettemegbirddizzyupvin-eedgarcerecerezvlivcarmansegunadebayosambeckercraigandrewsmjakobiskale-stewchloe.tedderpbtodaniel.campbellarian-vercelnutaalmonksamselikoffdcartertwobaruchadiejcaaorrisdoqueryantonathanhammondsnokohnjohnphamoustknickmanagadzikthomcroweemeraldsantoecklftimeyoutakeitcramforcebalazs4casey.gowriesamuel.fosterswarnavasenguptalydiahallieethan_arrowoodkwonojkakadiadarpanamanhimself_endangeredmassanick.traceyreconbotschlezcrowterligsoltisepallerolsdomyseenwienertarbwstephdietzgudmundurmarcgreenstockvvofalcoagustinnabsulbmealeymaedahbatoolbrethudsonmatt.strakajasongullicksonf3d0rgaspar09jtaylor0196pieparkerkellydferber90healeycodesbroph123codybrouwersgdbortonjeffreyarnesonebb-tidemsimulcikdomecclestonnutlopehungrybearstudiocodetaromiuragkaragkiaourisgeovanisouza92dglsparsonslostinpatternsvercel-release-botsouthpolestevematheussigorklopovnkzawatootallnaterauchgtimneutkensjavivelascoiamevilrabbitkdy1quietshustyflezeit-botlucleraymglagolaandybitzpaulogdmanatrajkovskatimerarzafranijjklfadesmsweeneydevwilliamliragojoseguybedfordskllcrnjanicklas-ralphatcastlespanickerhousseindjirdehgmonacokikobeatsprateekbhjkremsjaredpalmergielcobbenchibicodenazarenooviedosamsisleokbelhankvercelleerobinsonelsighjulianbenegasrizbizkitssokracl3arglasschriswdmrernestdismaelrumzanjhochmitchellwrightmrmckebkuvoscreationixhuozhicmvnkktcarterpadmaiadelbacatsaremlgsteventeygsandhudbredvick

Accepted risks

Findings the reviewer chose to accept rather than block on.

SourceRuleReasonAccepted byWhen
bogus-package bogus-package AI (bogus-package): Mass-production signal is from a Vercel team member; no-keywords is cosmetic. Package is the legitimate canonical arg CLI parser. ai
publish-pattern dormant-publish AI (publish-pattern): arg is a mature, stable utility; long dormancy between patch releases is expected. Change is minimal (removed pretest script). No signs of takeover. ai
email-domain unclaimed-email:wavetilt.com AI (email-domain): Author email domain is stale/unclaimed but package is the canonical vercel/arg with a large verified Vercel team maintainer list. Risk of impersonation is low given ecosystem context. ai
provenance no-provenance AI (provenance): Pre-Sigstore-era package from established publisher; no provenance is expected for this era of publishing. ai
maintainer-change maintainer-removed AI (maintainer-change): Removed maintainers (zeit-admin, zeit-bot, qix, etc.) reflect the same 2018 Zeit/Vercel organizational transition. No malicious indicators. ai
maintainer-change maintainer-added AI (maintainer-change): New maintainers added as part of the 2018 Zeit/Vercel team restructuring. Consistent with legitimate organizational change, not a takeover. ai
provenance publisher-changed AI (provenance): Publisher change from qix to timneutkens reflects a legitimate 2018 Vercel/Zeit organizational transition. timneutkens is a core Vercel team member with strong track record. ai
typosquat typosquat.levenshtein:yargs AI (typosquat): arg is a legitimate, long-standing package (vercel/arg); not a typosquat of yargs. ai
typosquat typosquat.levenshtein:pg AI (typosquat): arg is a legitimate, long-standing CLI argument parser; not a typosquat of pg. ai
typosquat typosquat.levenshtein:ajv AI (typosquat): arg is a legitimate, long-standing CLI argument parser; not a typosquat of ajv. ai

Versions (showing 14 of 14)

Version Deps Published
5.0.2 0 / 3
5.0.1 0 / 3
5.0.0 0 / 3
4.1.3 0 / 3
4.1.2 0 / 3
4.1.1 0 / 3
4.1.0 0 / 3
4.0.1 0 / 3
3.0.0 0 / 3
2.0.1 0 / 3
2.0.0 0 / 3
1.0.1 0 / 3
1.0.0 0 / 3
0.0.1 0 / 0

v5.0.1

3 findings
HIGH Publisher changed: qix → leerobinson (on 2021-08-17) provenance

This version was published by a different npm account than previous versions on 2021-08-17. This could indicate a legitimate maintainer transition or an account compromise.

HIGH Unclaimed maintainer email domain: wavetilt.com email-domain

Maintainer email '[email protected]' uses domain 'wavetilt.com' which has no DNS records. An attacker could register this domain to hijack the maintainer identity.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v5.0.0

2 findings
HIGH Unclaimed maintainer email domain: wavetilt.com email-domain

Maintainer email '[email protected]' uses domain 'wavetilt.com' which has no DNS records. An attacker could register this domain to hijack the maintainer identity.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v4.1.3

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v4.1.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v4.1.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v4.1.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v4.0.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v3.0.0

2 findings
HIGH Publisher changed: qix → timneutkens (on 2018-12-14) provenance

This version was published by a different npm account than previous versions on 2018-12-14. This could indicate a legitimate maintainer transition or an account compromise.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v2.0.1

2 findings
HIGH Publisher changed: qix → timneutkens (on 2018-11-14) provenance

This version was published by a different npm account than previous versions on 2018-11-14. This could indicate a legitimate maintainer transition or an account compromise.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v2.0.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v1.0.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v1.0.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.0.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.