All @mapbox/geojsonhint versions

@mapbox/geojsonhint @1.2.1

rejected
This version was rejected. It did not pass GreenFlagged's security review and is not served by the registry. The findings and risk dispositions below explain why.
85
Risk Score
ISC
License
No
Install Scripts
5
Dependencies
6
Dev Dependencies
17.0 KB
Package Size
Published

validate and sanity-check geojson files

Maintainers

aaronlidmanaarthykcajashtonajithrankaaliceykuoalinapazalulshamishas157amyleewandreasviglakisansisapendletonarunasankbatpadbenjamintdbhouselbkowshikbrendanmcfarlandbsudekumcamillacaroscamilleannechaupowcolleenmcginnisdanieljhdanpatdanswickdavidtheclarkdnomadbdthompsonemilymcafeeemilymduboisenffreenerdgeohackerghoshkajgretacbian29ianshwardingallsisiyujacquestardiejfirebaughjothirnadhjrpruit1kaibot3000kaidalgleishkarenzsheakaritotpkatydecorahkkaeferk-mahoneylaurierlbudlily-chail-rlucaswojlxbarthlyzidiamondmapbox-adminmapsammateovmattfickemayaqgaomcwhittemoremiccolismiles-devmokobmollymerpmorganherlockermournermsirenkonatslaughternickcordellanickidlugashoinioxidasepdgoodmanperrygeoplanemadpratikyadavrclarkrodowirub21rumcryan-baumannsaikia.abhisheksamanbbsbma44scothisspringmeyersrividyacbtcqlthemarextmcwtony-cjtristenuvollmervincentsvirginiayungwho8mycakeswillwhitexrwangyhahnzmully

Keywords

geojsonhint

Dependencies (5)

PackageConstraintRegistry Status
chalk ^1.1.0 auto_approved
minimist 1.1.1 No greenflagged match
text-table ^0.2.0 auto_approved
concat-stream ~1.4.4 auto_approved
jsonlint-lines 1.7.1 auto_approved

Dev Dependencies (6)

PackageConstraintRegistry Status
tap ~1.3.1 auto_approved
glob ~3.2.6 auto_approved
eslint ^1.10.3 No greenflagged match
fuzzer ~0.1.0 Not imported
benchmark ^1.0.0 auto_approved
eslint-config-unstyled ^1.1.0 Not imported

Transitive Dependency Tree

20 transitive deps max depth 4
  ├─ chalk ^1.1.0 → 1.1.3
  ├─ concat-stream ~1.4.4 → 1.4.11
  ├─ jsonlint-lines 1.7.1 → 1.7.1
  ├─ minimist 1.1.1
├─ text-table ^0.2.0 → 0.2.0
  ├─ ansi-styles ^2.2.1 → 2.2.1
  ├─ escape-string-regexp ^1.0.2 → 1.0.5
  ├─ has-ansi ^2.0.0 → 2.0.0
  ├─ inherits ~2.0.1 → 2.0.4
  ├─ nomnom >= 1.5.x → 1.8.1
  ├─ readable-stream ~1.1.9 → 1.1.14
  ├─ strip-ansi ^3.0.0 → 3.0.1
  ├─ supports-color ^2.0.0 → 2.0.0
├─ typedarray ~0.0.5 → 0.0.7
  ├─ ansi-regex ^2.0.0 → 2.1.1
  ├─ chalk ~0.4.0 → 0.4.0
  ├─ core-util-is ~1.0.0 → 1.0.3
  ├─ inherits ~2.0.1 → 2.0.4
  ├─ isarray 0.0.1
  ├─ string_decoder ~0.10.x → 0.10.31
├─ underscore ~1.6.0
  ├─ ansi-styles ~1.0.0 → 1.0.0
  ├─ has-color ~0.1.0 → 0.1.7
  ├─ strip-ansi ~0.1.0

Changes from v2.0.0

Dependency Changes

ChangePackageVersion
added chalk ^1.1.0
added text-table ^0.2.0
removed vfile 2.0.0
removed vfile-reporter 3.0.0
changed minimist 1.2.0 → 1.1.1
changed concat-stream ~1.5.1 → ~1.4.4

Script Changes

- prepublish

File Changes

7 added 3 removed 5 modified size delta: -16.8 KB

Risk Dispositions (2 applicable to this version, 0 other)

Accepted rules are downgraded to INFO on future analyses; rejected rules escalate to CRITICAL.

Rule Source Disposition Author Reason
unclaimed-email:gmail.colm email-domain reject AI AI (email-domain): Typo domain gmail.colm is unregistered and could be claimed by an attacker to hijack maintainer identity. This risk persists across all versions until the email is corrected.
unclaimed-email:wilhel.me email-domain reject AI AI (email-domain): Domain wilhel.me has no DNS records and could be registered by an attacker to hijack maintainer identity. Risk persists until email is corrected.

SAST Findings (3)

HIGH Unclaimed maintainer email domain: gmail.colm email-domain

Maintainer email '[email protected]' uses domain 'gmail.colm' which has no DNS records. An attacker could register this domain to hijack the maintainer identity.

HIGH Unclaimed maintainer email domain: wilhel.me email-domain

Maintainer email '[email protected]' uses domain 'wilhel.me' which has no DNS records. An attacker could register this domain to hijack the maintainer identity.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

Review Summary

Risk score: 85. Findings: 2 high (+50), 2 medium (+20), 5 low (+15).

Commit: d4d01037ef8f Browse source

Published to npm: